PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015095-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 430aa    MW: 48590.2 Da    PI: 7.3727
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015095-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.4e-15119164147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v  +G+ +W++Ia+++  gR++k+c++rw++ 
  AHYPO_015095-RA 119 RGHWRPAEDSKLKELVGIYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 164
                      899*****************************.***********996 PP

2Myb_DNA-binding569.3e-18171214146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  AHYPO_015095-RA 171 RRAFTEEEEERLMQAHRVYGNK-WAMIARLFP-GRTDNAVKNHWHV 214
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.148114165IPR017930Myb domain
SMARTSM007171.9E-13118167IPR001005SANT/Myb domain
PfamPF002491.3E-14119164IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-28119212IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-25120172IPR009057Homeodomain-like
CDDcd001671.82E-12122163No hitNo description
PROSITE profilePS5129427.255166220IPR017930Myb domain
SMARTSM007172.4E-14170218IPR001005SANT/Myb domain
PfamPF002492.1E-14171213IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-21173219IPR009057Homeodomain-like
CDDcd001671.05E-11173213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MGMIPFPDLT SLSLKKPNFF GTMPTSEDPS NNRGGFPFMG SFIPQIDGDE QAVIQGKVCN  60
FKDGISSMDL NNTSCEDEIS FGHENNNINN NNNNNNNNNN NNNNNSKVEC SKESKVCARG  120
HWRPAEDSKL KELVGIYGPQ NWNLIAEKLE GRSGKSCRLR WFNQLDPRIN RRAFTEEEEE  180
RLMQAHRVYG NKWAMIARLF PGRTDNAVKN HWHVIMARKY REQSNAFRRR RNNLMQHQSS  240
SPSSTFPHHH HHHLRRSTSS SSSMDEDHEH QLPNSYNNNY HGNISHVANG INMSNQASSF  300
PSNSHQAPLD FFSGPSNHNM VSMLSGSRCL DRAIQIPIAM AMPMQVQQQE EEQSYYYYYY  360
NNNNNNNNNN NNNNTSLPSH HQLISPPQTH PYSSSPPSLE AASGSRSVED PTSTSSLPFI  420
DFLGVGSST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-331192197107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683161.11e-145PREDICTED: transcription factor MYB28-like
TrEMBLA0A0J8EV621e-137A0A0J8EV62_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-75myb domain protein 105